PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g16730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 460aa    MW: 52343.8 Da    PI: 6.4146
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g16730.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.4e-12215255445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W ++E+ ll++a++++G g+W+ +a+++g +++   c+++++
   Vang03g16730.1 215 WNADEEILLLEAIEMYGFGNWNEVAEYVG-TKSKSRCIDHYN 255
                      *****************************.999999*****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002911.3E-94489IPR000433Zinc finger, ZZ-type
SuperFamilySSF578504.36E-1548102No hitNo description
PfamPF005691.8E-94888IPR000433Zinc finger, ZZ-type
CDDcd023353.79E-244896No hitNo description
PROSITE profilePS5013510.5874891IPR000433Zinc finger, ZZ-type
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
PROSITE profilePS5129320.164210262IPR017884SANT domain
SuperFamilySSF466893.66E-12210261IPR009057Homeodomain-like
SMARTSM007179.4E-11211260IPR001005SANT/Myb domain
PfamPF002493.9E-12214255IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-7215256IPR009057Homeodomain-like
CDDcd001674.06E-11215255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MGRCRAASAT GPADDDPNHR LKRKRAASEN SETLATVQGI ANSKVSLYHC NYCNKDISGR  60
IRIKCAVCQD FDLCIECFSI GAEVTPHKSN HPYRVMLISM SSEIGRSEWI NDVDDGGTLA  120
RKATFMLAAE QLGFSPSTVV RKSFSNWEFF WIRAILRLIS RCLHGGYLCE EDDALKPVAD  180
ARKRDMIHGG GDMILMPPSH CHVDNLCFPL ICPDWNADEE ILLLEAIEMY GFGNWNEVAE  240
YVGTKSKSRC IDHYNAVYMN SPCFPLPDLS HVMGKSRDEL FAMVKRHEAK KDFSLTAELM  300
LKEEAPFSDV LSFEETKEAE INNLEISRLT SACGKSCSST VKKTSNLSQS KEVKVEGMFS  360
DADMSDTLCR LDERKRRKHF VLERELLYLD PFEKSLLPEE LQICQHYKVF MRFHSKEQHQ  420
DFLKNIIEEH RLVKRIQDLQ VTHSSTHYGD VTTLYPEIL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-163AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014621864.11e-118PREDICTED: transcriptional adapter ADA2b-like isoform X6
SwissprotQ9ATB42e-64TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLK7LYC21e-118K7LYC2_SOYBN; Uncharacterized protein
STRINGGLYMA13G11200.21e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726